PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG014579.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 658aa    MW: 74127.4 Da    PI: 5.3463
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG014579.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3512.22.4e-156464261354
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+mll+rlke+ k+     e+ ++ +k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWkek
  CCG014579.1  46 DELERRMWRDRMLLRRLKEQGKN----TEV-VDHAKHRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEK 138
                  79*****************9997....566.999**************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaaiskyqa++ i+++++++   + s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPt +e+ww++lgl+kdqg+ppyk
  CCG014579.1 139 VRFDRNGPAAISKYQADHSIPGKSEDCGP-AASTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVAPPWWPTANEEWWPQLGLPKDQGPPPYK 235
                  ***************************77.89****************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXXXXXXXXXXXXXXXX.XXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqspkvtlsceqkedve.gkkesk 291
                  kphdlkkawkvsvLtavikh+sp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee + ++++++  ++ +  +s + ++s+++++dve +++e++
  CCG014579.1 236 KPHDLKKAWKVSVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEETLSRKLYPDscPPVSAGGSGSCVISDSSDYDVEgVDDEPN 333
                  *******************************************************************65446677****************7777777 PP

                  .XXXXXXXXXX................................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
         EIN3 292 ikhvqavktta................................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                    +v+ +k+ +                                ++++++krk++ +e+ +  +++v + c++ q++++++ l+f d ++++++++
  CCG014579.1 334 -VEVEDCKRLDvnlfnmataagprdrfmmppaapqikgelvetSMDFIQKRKQPAGEPHMLVDQKV-YRCEHPQCPYNDSGLGFLDITARNNHQM 426
                  .55777777678************************************************999986.**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.8E-13046293No hitNo description
Gene3DG3DSA:1.10.3180.105.5E-75168303IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.72E-61172295IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MGIFEEMGFC NNLDFFSAPG EMDAVPEREP GATIEEDYSD EEMDVDELER RMWRDRMLLR  60
RLKEQGKNTE VVDHAKHRQS QEQARRKKMS RAQDGILKYM LKMMEVCKAQ GFVYGIIPEK  120
GKPVSGASDN LRGWWKEKVR FDRNGPAAIS KYQADHSIPG KSEDCGPAAS TPHTLQELQD  180
TTLGSLLSAL MQHCDPPQRR FPLEKGVAPP WWPTANEEWW PQLGLPKDQG PPPYKKPHDL  240
KKAWKVSVLT AVIKHISPDI AKIRKLVRQS KCLQDKMTAK ESATWLAIIN QEETLSRKLY  300
PDSCPPVSAG GSGSCVISDS SDYDVEGVDD EPNVEVEDCK RLDVNLFNMA TAAGPRDRFM  360
MPPAAPQIKG ELVETSMDFI QKRKQPAGEP HMLVDQKVYR CEHPQCPYND SGLGFLDITA  420
RNNHQMNCLY RTNASQGLGL SNFQINSDKP AVFSLPFPQT KAAAPNQTPS FNVSGLGLPE  480
DGKKSISDLM SFYDTNLQRD KNMNPGSANV IGDQNQQQLQ EQKFQFQLNP RNVNFMGDQN  540
PQQQQKFQFQ LDPRNANIIG GQNQQQQQKF QFQLDDSFYG QGAMAGNNIT EATSMPVNNA  600
VFSSTENQFD HCKAFDSAFD TNVSDNITDF RFGSPFPSPP VDYSMDLIPK QDVGMWYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-821703031134Protein ETHYLENE INSENSITIVE 3
4zds_B5e-821703031134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2254350.0CU225435.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046481.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_011046482.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLB9HVF70.0B9HVF7_POPTR; EIN3-like family protein
STRINGPOPTR_0010s25370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein